PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT33035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 142aa    MW: 15570.6 Da    PI: 10.5335
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT33035genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.91.8e-3265123159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  EMT33035  65 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLAEDPRMVITTYEGRHVHS 123
               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.4E-3450123IPR003657WRKY domain
SuperFamilySSF1182909.55E-2957124IPR003657WRKY domain
PROSITE profilePS5081129.12660125IPR003657WRKY domain
SMARTSM007745.3E-3665124IPR003657WRKY domain
PfamPF031063.0E-2566122IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MGINSAAAGG SGGGERSHGS SSAAAGMGVG AVRMKKAAGG GGAKARRKVR EPRFCFKTMS  60
DVDVLDDGYK WRKYGQKVVK NTQHPRSYYR CTQDKCRVKK RVERLAEDPR MVITTYEGRH  120
VHSPSRDDDD AARASAEMSF IW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2756122874Probable WRKY transcription factor 4
2lex_A2e-2756122874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1087551e-139AK108755.1 Oryza sativa Japonica Group cDNA clone:002-150-F11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132878.19e-70putative WRKY DNA-binding domain superfamily protein
SwissprotQ9SVB73e-59WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLM8C6R61e-101M8C6R6_AEGTA; Putative WRKY transcription factor 13
STRINGGRMZM2G151444_P013e-69(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.16e-49WRKY DNA-binding protein 13